Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TF Peptide - C-terminal region

TF Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp781D0156, PRO1557, PRO2086, TFQTL1

UniProt

P02787

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TF Rabbit Polyclonal Antibody (orb585487) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001054

Preservative

Lyophilized powder

AA Sequence

IAGKCGLVPVLAENYNKSDNCEDTPEAGYFAVAVVKKSASDLTWDNLKGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLCXD3 (NM_001005473) Human Tagged Lenti ORF Clone
RC219570L4 10 µg

PLCXD3 (NM_001005473) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PGAM1, 1-254aa, Human, His-tag, E Coli (Bioactivity Validated)
MBS206433-01 0.01 mg

PGAM1, 1-254aa, Human, His-tag, E Coli (Bioactivity Validated)

Sign In for Pricing
View Details
PGAM1, 1-254aa, Human, His-tag, E Coli (Bioactivity Validated)
MBS206433-02 0.02 mg

PGAM1, 1-254aa, Human, His-tag, E Coli (Bioactivity Validated)

Sign In for Pricing
View Details
PGAM1, 1-254aa, Human, His-tag, E Coli (Bioactivity Validated)
MBS206433-03 0.05 mg

PGAM1, 1-254aa, Human, His-tag, E Coli (Bioactivity Validated)

Sign In for Pricing
View Details
PGAM1, 1-254aa, Human, His-tag, E Coli (Bioactivity Validated)
MBS206433-04 0.1 mg

PGAM1, 1-254aa, Human, His-tag, E Coli (Bioactivity Validated)

Sign In for Pricing
View Details
PGAM1, 1-254aa, Human, His-tag, E Coli (Bioactivity Validated)
MBS206433-05 5x 0.01 mg

PGAM1, 1-254aa, Human, His-tag, E Coli (Bioactivity Validated)

Sign In for Pricing
View Details