Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD2 Peptide - C-terminal region

CD2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ46032, SRBC, T11

UniProt

P06729

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD2 Rabbit Polyclonal Antibody (orb585488) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001758

Preservative

Lyophilized powder

AA Sequence

TTSLSAKFKCTAGNKVSKESSVEPVSCPEKGLDIYLIIGICGGGSLLMVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH
552391 100 µg

ACTH

Sign In for Pricing
View Details
RGD1309095 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6534407 1.0 µg DNA

RGD1309095 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Vegfb sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4356708 1.0 µg DNA

Vegfb sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
OR4D7P Protein Lysate (Human) with C-Ha Tag
35202031 100 µg

OR4D7P Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Monkey Melanocortin receptor 4 (MC4R) ELISA Kit
MBS7215446-01 48 Well

Monkey Melanocortin receptor 4 (MC4R) ELISA Kit

Sign In for Pricing
View Details
Monkey Melanocortin receptor 4 (MC4R) ELISA Kit
MBS7215446-02 96 Well

Monkey Melanocortin receptor 4 (MC4R) ELISA Kit

Sign In for Pricing
View Details