Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD2 Peptide - C-terminal region

CD2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ46032, SRBC, T11

UniProt

P06729

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD2 Rabbit Polyclonal Antibody (orb585488) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001758

Preservative

Lyophilized powder

AA Sequence

TTSLSAKFKCTAGNKVSKESSVEPVSCPEKGLDIYLIIGICGGGSLLMVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse GNb1 (G Protein Beta 1) ELISA Kit
RE3241M-01 48 Tests

Mouse GNb1 (G Protein Beta 1) ELISA Kit

Sign In for Pricing
View Details
Mouse GNb1 (G Protein Beta 1) ELISA Kit
RE3241M-02 96 Tests

Mouse GNb1 (G Protein Beta 1) ELISA Kit

Sign In for Pricing
View Details
Human Mannose Associated Serine Protease 1 (MASP1) ELISA Kit
YLA0333HU-01 48 Tests

Human Mannose Associated Serine Protease 1 (MASP1) ELISA Kit

Sign In for Pricing
View Details
Human Mannose Associated Serine Protease 1 (MASP1) ELISA Kit
YLA0333HU-02 96 Tests

Human Mannose Associated Serine Protease 1 (MASP1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Zinc finger protein 837 (ZNF837)
MBS1471537-01 0.02 mg (E-Coli)

Recombinant Human Zinc finger protein 837 (ZNF837)

Sign In for Pricing
View Details
Recombinant Human Zinc finger protein 837 (ZNF837)
MBS1471537-02 0.02 mg (Yeast)

Recombinant Human Zinc finger protein 837 (ZNF837)

Sign In for Pricing
View Details