Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD2 Peptide - C-terminal region

CD2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ46032, SRBC, T11

UniProt

P06729

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD2 Rabbit Polyclonal Antibody (orb585488) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001758

Preservative

Lyophilized powder

AA Sequence

TTSLSAKFKCTAGNKVSKESSVEPVSCPEKGLDIYLIIGICGGGSLLMVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCBE1 Conjugated Antibody
C44510 100 µL

CCBE1 Conjugated Antibody

Sign In for Pricing
View Details
BLM (BLM, Bloom Syndrome Protein, Bloom Syndrome, RecQ Helicase-like, BS, DNA Helicase, RecQ-like Type 2, MGC126616, MGC131618, MGC131620, RecQ Protein-like 3, RECQ2, RECQL2, RECQL3) discontinued
253945 100 µL

BLM (BLM, Bloom Syndrome Protein, Bloom Syndrome, RecQ Helicase-like, BS, DNA Helicase, RecQ-like Type 2, MGC126616, MGC131618, MGC131620, RecQ Protein-like 3, RECQ2, RECQL2, RECQL3) discontinued

Sign In for Pricing
View Details
Epo-R (Phospho-Tyr368) Antibody
MBS8585266-01 0.1 mg

Epo-R (Phospho-Tyr368) Antibody

Sign In for Pricing
View Details
Epo-R (Phospho-Tyr368) Antibody
MBS8585266-02 0.1 mL (AF405L)

Epo-R (Phospho-Tyr368) Antibody

Sign In for Pricing
View Details
Epo-R (Phospho-Tyr368) Antibody
MBS8585266-03 0.1 mL (AF405S)

Epo-R (Phospho-Tyr368) Antibody

Sign In for Pricing
View Details
Epo-R (Phospho-Tyr368) Antibody
MBS8585266-04 0.1 mL (AF610)

Epo-R (Phospho-Tyr368) Antibody

Sign In for Pricing
View Details