Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD68 Peptide - N-terminal region

CD68 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp686M18236, GP110, SCARD1, LAMP4

UniProt

P34810

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD68 Rabbit Polyclonal Antibody (orb585500) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001242

Preservative

Lyophilized powder

AA Sequence

LLAAQGTGNDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AG-1296
SIH-426-25MG 25 mg

AG-1296

Sign In for Pricing
View Details
FOXI1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7G9]
TA800141BM 100 µL

FOXI1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7G9]

Sign In for Pricing
View Details
Zonula occludens protein 3 (TJP3) (N-term) Rabbit Polyclonal Antibody
AP54262PU-N 400 µL

Zonula occludens protein 3 (TJP3) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AMPK Activator 991
TRC-A634308-5MG 5 mg

AMPK Activator 991

Sign In for Pricing
View Details
1-Hydroxy-4-(p-tolylamino)anthracene-9,10-dione
TRC-H951118-1G 1 g

1-Hydroxy-4-(p-tolylamino)anthracene-9,10-dione

Sign In for Pricing
View Details
RHOA Human Gene Knockout Kit (CRISPR)
KN203303 1 Kit

RHOA Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details