Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AQP4 Peptide - C-terminal region

AQP4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HMIWC2, MGC22454, MIWC

UniProt

P55087

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AQP4 Rabbit Polyclonal Antibody (orb585563) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001641

Preservative

Lyophilized powder

AA Sequence

QQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UNC13B Human Gene Knockout Kit (CRISPR)
KN419186 1 Kit

UNC13B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Horseradish Peroxidase Conjugated Goat Polyclonal Antibody to Human IgM
PA-2102-1 1 mL

Horseradish Peroxidase Conjugated Goat Polyclonal Antibody to Human IgM

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR566337 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
Human IMPACT activation kit by CRISPRa
GA110739 1 Kit

Human IMPACT activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Protein Lysate, Lung
CP565843 150 µg

Tissue Protein Lysate, Lung

Sign In for Pricing
View Details
BMP5 Rabbit Polyclonal Antibody
TA372126 100 µL

BMP5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details