Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD48 Peptide - N-terminal region

CD48 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BCM1, BLAST, BLAST1, MEM-102, SLAMF2, hCD48, mCD48

UniProt

P09326

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD48 Rabbit Polyclonal Antibody (orb585604) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001769

Preservative

Lyophilized powder

AA Sequence

KSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSP94 siRNA (m)
sc-76281 10 µM

PSP94 siRNA (m)

Sign In for Pricing
View Details
Mouse H2A Histone Family Member X (H2AFX) ELISA Kit
MBS9902767-01 48 Well

Mouse H2A Histone Family Member X (H2AFX) ELISA Kit

Sign In for Pricing
View Details
Mouse H2A Histone Family Member X (H2AFX) ELISA Kit
MBS9902767-02 96 Well

Mouse H2A Histone Family Member X (H2AFX) ELISA Kit

Sign In for Pricing
View Details
Mouse H2A Histone Family Member X (H2AFX) ELISA Kit
MBS9902767-03 5x 96 Well

Mouse H2A Histone Family Member X (H2AFX) ELISA Kit

Sign In for Pricing
View Details
Mouse H2A Histone Family Member X (H2AFX) ELISA Kit
MBS9902767-04 10x 96 Well

Mouse H2A Histone Family Member X (H2AFX) ELISA Kit

Sign In for Pricing
View Details
ZFR antibody - C-terminal region (ARP39227_P050)
ARP39227_P050 100 µL

ZFR antibody - C-terminal region (ARP39227_P050)

Sign In for Pricing
View Details