Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD48 Peptide - N-terminal region

CD48 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BCM1, BLAST, BLAST1, MEM-102, SLAMF2, hCD48, mCD48

UniProt

P09326

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD48 Rabbit Polyclonal Antibody (orb585604) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001769

Preservative

Lyophilized powder

AA Sequence

KSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF546 Human qPCR Primer Pair (NM_178544)
HP218869 200 Reactions

ZNF546 Human qPCR Primer Pair (NM_178544)

Sign In for Pricing
View Details
Radicicol
MBS807924-01 1 mg

Radicicol

Sign In for Pricing
View Details
Radicicol
MBS807924-02 5x 1 mg

Radicicol

Sign In for Pricing
View Details
CST1 Antibody
OACA06704-50UL 50 µL

CST1 Antibody

Sign In for Pricing
View Details
Mouse Actn4 activation kit by CRISPRa
GA206405 1 Kit

Mouse Actn4 activation kit by CRISPRa

Sign In for Pricing
View Details
Anti-Baker's yeast UBP8 Antibody, Dylight594 Conjugate
DZ41210-Dylight594 200 µL

Anti-Baker's yeast UBP8 Antibody, Dylight594 Conjugate

Sign In for Pricing
View Details