Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB11A Peptide - C-terminal region

RAB11A Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC1490, YL8

UniProt

P62491

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB11A Rabbit Polyclonal Antibody (orb585751) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004654

Preservative

Lyophilized powder

AA Sequence

FQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LSS Human shRNA Plasmid Kit (Locus ID 4047)
TL311653 1 Kit

LSS Human shRNA Plasmid Kit (Locus ID 4047)

Sign In for Pricing
View Details
N- (Ethyl-d5) Propan-2-Amine Hydrochloride
CS-T-102460 1 Each

N- (Ethyl-d5) Propan-2-Amine Hydrochloride

Sign In for Pricing
View Details
1700026L06Rik Antibody - C-terminal region (ARP53733_P050)
ARP53733_P050 100 µL

1700026L06Rik Antibody - C-terminal region (ARP53733_P050)

Sign In for Pricing
View Details
Extracellular serine protease Antibody
MBS7164852 Inquire

Extracellular serine protease Antibody

Sign In for Pricing
View Details
CS Rabbit Monoclonal Antibody [Clone ID: 23GB780]
TA424658 100 µL

CS Rabbit Monoclonal Antibody [Clone ID: 23GB780]

Sign In for Pricing
View Details
FHAD1 Polyclonal Antibody, RBITC Conjugated
bs-13171R-RBITC 100 µL

FHAD1 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details