Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB11A Peptide - C-terminal region

RAB11A Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC1490, YL8

UniProt

P62491

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB11A Rabbit Polyclonal Antibody (orb585751) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004654

Preservative

Lyophilized powder

AA Sequence

FQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Tau (Ser202) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-11240R-BF680-TR 20 µL

Phospho-Tau (Ser202) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
2-Chloro-N-[ (4-methoxyphenyl) methyl]-N-methylacetamide
BJB16912-01 250 mg

2-Chloro-N-[ (4-methoxyphenyl) methyl]-N-methylacetamide

Sign In for Pricing
View Details
2-Chloro-N-[ (4-methoxyphenyl) methyl]-N-methylacetamide
BJB16912-02 2.5 g

2-Chloro-N-[ (4-methoxyphenyl) methyl]-N-methylacetamide

Sign In for Pricing
View Details
Tmprss11a Mouse shRNA Plasmid (Locus ID 194597)
TL510256 1 Kit

Tmprss11a Mouse shRNA Plasmid (Locus ID 194597)

Sign In for Pricing
View Details
PHB Antibody
CSB-PA926901-01 50 μL

PHB Antibody

Sign In for Pricing
View Details
PHB Antibody
CSB-PA926901-02 100 µL

PHB Antibody

Sign In for Pricing
View Details