Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB11A Peptide - C-terminal region

RAB11A Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC1490, YL8

UniProt

P62491

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB11A Rabbit Polyclonal Antibody (orb585751) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004654

Preservative

Lyophilized powder

AA Sequence

FQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAF6 Rabbit mAb
C05632-100ul 100 µL

TRAF6 Rabbit mAb

Sign In for Pricing
View Details
Anti-Fibronectin  produced in mouse
Y060803 100 µL

Anti-Fibronectin produced in mouse

Sign In for Pricing
View Details
ANGPTL3 (Angiopoietin-like 3, ANGPT5) (APC)
243329-APC 100 µL

ANGPTL3 (Angiopoietin-like 3, ANGPT5) (APC)

Sign In for Pricing
View Details
HUILESOLUBLE355X37CARD-T1-P18 Pipe Markers for Oils
N003039 3 Card (3 Marker (s) x 1 Card)

HUILESOLUBLE355X37CARD-T1-P18 Pipe Markers for Oils

Sign In for Pricing
View Details
Rheumatoid Factor IgA ELISA
MBS494689-ORG522A-01 96 Tests

Rheumatoid Factor IgA ELISA

Sign In for Pricing
View Details
Rheumatoid Factor IgA ELISA
MBS494689-ORG522A-02 5x 96 Tests

Rheumatoid Factor IgA ELISA

Sign In for Pricing
View Details