Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB11A Peptide - C-terminal region

RAB11A Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC1490, YL8

UniProt

P62491

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB11A Rabbit Polyclonal Antibody (orb585751) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004654

Preservative

Lyophilized powder

AA Sequence

FQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBAP1L (NM_001163692) Human Tagged ORF Clone
RG228306 10 µg

UBAP1L (NM_001163692) Human Tagged ORF Clone

Sign In for Pricing
View Details
TRIM64 Antibody
orb1269056 400 μl

TRIM64 Antibody

Sign In for Pricing
View Details
AIMP2 (NM_006303) Human Untagged Clone
SC116211 10 µg

AIMP2 (NM_006303) Human Untagged Clone

Sign In for Pricing
View Details
MYO1A Antibody
E38QA5162 100 µL

MYO1A Antibody

Sign In for Pricing
View Details
Factor I Antibody / CFI
R32399 100 µg

Factor I Antibody / CFI

Sign In for Pricing
View Details
PBP Recombinant Antibody, HRP Conjugated
bsm-61243R-HRP-TR 20 µL

PBP Recombinant Antibody, HRP Conjugated

Sign In for Pricing
View Details