IL3RA Peptide - C-terminal region
IL3RA Peptide - C-terminal region
Product Specifications
Product Name Alternative
CD123, IL3R, IL3RAY, IL3RX, IL3RY, MGC34174, hIL-3Ra
UniProt
P26951
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IL3RA Rabbit Polyclonal Antibody (orb585755) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002174
Preservative
Lyophilized powder
AA Sequence
IQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-UNEL-M0197-01 5x 96 Tests
Uncoated Mouse M-CSF R (Macrophage colony-stimulating factor 1 receptor) ELISA Kit
Sign In for Pricing
View Details E-UNEL-M0197-02 15x 96 Tests
Uncoated Mouse M-CSF R (Macrophage colony-stimulating factor 1 receptor) ELISA Kit
Sign In for Pricing
View Details 
RDR-NTXI-Ra-01 96 Tests
Rat Cross Linked N-Telopeptide Of Type I Collagen (NTXI) ELISA Kit
Sign In for Pricing
View Details RDR-NTXI-Ra-02 48 Tests
Rat Cross Linked N-Telopeptide Of Type I Collagen (NTXI) ELISA Kit
Sign In for Pricing
View Details 
