Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL3RA Peptide - C-terminal region

IL3RA Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD123, IL3R, IL3RAY, IL3RX, IL3RY, MGC34174, hIL-3Ra

UniProt

P26951

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IL3RA Rabbit Polyclonal Antibody (orb585755) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002174

Preservative

Lyophilized powder

AA Sequence

IQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Pancreas
CS803388 5x 5 µm

Tissue FFPE Sections, Pancreas

Sign In for Pricing
View Details
CT45A10 (NM_001291530) Human Tagged ORF Clone
RG236416 10 µg

CT45A10 (NM_001291530) Human Tagged ORF Clone

Sign In for Pricing
View Details
PRELID2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A2]
TA810790BM 100 µL

PRELID2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A2]

Sign In for Pricing
View Details
BTNL8 CytoSection
TS412534P5 25 Slides

BTNL8 CytoSection

Sign In for Pricing
View Details
Tissue FFPE Sections, Uterus
CS808612 5x 5 µm

Tissue FFPE Sections, Uterus

Sign In for Pricing
View Details
CKAP4 Antibody
KC-24986-01 50 μL

CKAP4 Antibody

Sign In for Pricing
View Details