Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CKB Peptide - N-terminal region

CKB Peptide - N-terminal region

Product Specifications

Product Name Alternative

B-CK, CKBB

UniProt

P12277

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CKB Rabbit Polyclonal Antibody (orb585756) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001814

Preservative

Lyophilized powder

AA Sequence

DNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMAD2/3 Antibody
orb1177310 100 µg

SMAD2/3 Antibody

Sign In for Pricing
View Details
Methyl 4-[2-amino-4- (piperidine-1-sulfonyl) phenoxy]benzoate
KEB32272-01 0.5 g

Methyl 4-[2-amino-4- (piperidine-1-sulfonyl) phenoxy]benzoate

Sign In for Pricing
View Details
Methyl 4-[2-amino-4- (piperidine-1-sulfonyl) phenoxy]benzoate
KEB32272-02 5 g

Methyl 4-[2-amino-4- (piperidine-1-sulfonyl) phenoxy]benzoate

Sign In for Pricing
View Details
Rabbit Polyclonal NAALADase-like 1/NAALADL1 Antibody
NBP2-99724-50ul 50 µL

Rabbit Polyclonal NAALADase-like 1/NAALADL1 Antibody

Sign In for Pricing
View Details
Actr1b sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4977202 1.0 µg DNA

Actr1b sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Secretin receptor Polyclonal Antibody, APC Conjugated
bs-0089R-APC 100 µL

Secretin receptor Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details