Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CKB Peptide - N-terminal region

CKB Peptide - N-terminal region

Product Specifications

Product Name Alternative

B-CK, CKBB

UniProt

P12277

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CKB Rabbit Polyclonal Antibody (orb585756) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001814

Preservative

Lyophilized powder

AA Sequence

DNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRP-Linked Polyclonal Antibody to Tyrosinase (TYR)
MBS2040017-01 0.1 mL

HRP-Linked Polyclonal Antibody to Tyrosinase (TYR)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Tyrosinase (TYR)
MBS2040017-02 0.2 mL

HRP-Linked Polyclonal Antibody to Tyrosinase (TYR)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Tyrosinase (TYR)
MBS2040017-03 0.5 mL

HRP-Linked Polyclonal Antibody to Tyrosinase (TYR)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Tyrosinase (TYR)
MBS2040017-04 1 mL

HRP-Linked Polyclonal Antibody to Tyrosinase (TYR)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Tyrosinase (TYR)
MBS2040017-05 5 mL

HRP-Linked Polyclonal Antibody to Tyrosinase (TYR)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Tyrosinase (TYR)
MBS2040017-06 5x 5 mL

HRP-Linked Polyclonal Antibody to Tyrosinase (TYR)

Sign In for Pricing
View Details