Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CKB Peptide - C-terminal region

CKB Peptide - C-terminal region

Product Specifications

Product Name Alternative

B-CK, CKBB

UniProt

P06732

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CKB Rabbit Polyclonal Antibody (orb585757) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001814

Preservative

Lyophilized powder

AA Sequence

PSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGV

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF490 Peptide - N-terminal region (AAP35978)
AAP35978-100UG 100 µg

ZNF490 Peptide - N-terminal region (AAP35978)

Sign In for Pricing
View Details
2-Cyano-2- (2,3-dihydro-3-oxo-1H-isoindol-1-ylidene) -N-methylacetamide
FC184342-01 10 mg

2-Cyano-2- (2,3-dihydro-3-oxo-1H-isoindol-1-ylidene) -N-methylacetamide

Sign In for Pricing
View Details
2-Cyano-2- (2,3-dihydro-3-oxo-1H-isoindol-1-ylidene) -N-methylacetamide
FC184342-02 25 mg

2-Cyano-2- (2,3-dihydro-3-oxo-1H-isoindol-1-ylidene) -N-methylacetamide

Sign In for Pricing
View Details
2-Cyano-2- (2,3-dihydro-3-oxo-1H-isoindol-1-ylidene) -N-methylacetamide
FC184342-03 50 mg

2-Cyano-2- (2,3-dihydro-3-oxo-1H-isoindol-1-ylidene) -N-methylacetamide

Sign In for Pricing
View Details
2-Cyano-2- (2,3-dihydro-3-oxo-1H-isoindol-1-ylidene) -N-methylacetamide
FC184342-04 100 mg

2-Cyano-2- (2,3-dihydro-3-oxo-1H-isoindol-1-ylidene) -N-methylacetamide

Sign In for Pricing
View Details
D-Ribose 5-phosphate (disodium dihydrate) (Standard)
HY-W009371CR 1 Each

D-Ribose 5-phosphate (disodium dihydrate) (Standard)

Sign In for Pricing
View Details