Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CKB Peptide - C-terminal region

CKB Peptide - C-terminal region

Product Specifications

Product Name Alternative

B-CK, CKBB

UniProt

P06732

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CKB Rabbit Polyclonal Antibody (orb585757) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001814

Preservative

Lyophilized powder

AA Sequence

PSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRAS G12C mutant protein inhibitor A-1
T77805-01 5 mg

KRAS G12C mutant protein inhibitor A-1

Sign In for Pricing
View Details
KRAS G12C mutant protein inhibitor A-1
T77805-02 50 mg

KRAS G12C mutant protein inhibitor A-1

Sign In for Pricing
View Details
Pyrimidin-5-ylmethanamine dihydrochloride
OR1073432-01 50 mg

Pyrimidin-5-ylmethanamine dihydrochloride

Sign In for Pricing
View Details
Pyrimidin-5-ylmethanamine dihydrochloride
OR1073432-02 100 mg

Pyrimidin-5-ylmethanamine dihydrochloride

Sign In for Pricing
View Details
Pyrimidin-5-ylmethanamine dihydrochloride
OR1073432-03 250 mg

Pyrimidin-5-ylmethanamine dihydrochloride

Sign In for Pricing
View Details
Pyrimidin-5-ylmethanamine dihydrochloride
OR1073432-04 1 g

Pyrimidin-5-ylmethanamine dihydrochloride

Sign In for Pricing
View Details