Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THEMIS Peptide - C-terminal region

THEMIS Peptide - C-terminal region

Product Specifications

Product Name Alternative

C6orf190, C6orf207, FLJ40584, MGC163388, TSEPA, bA325O24.3, bA325O24.4, GASP, SPOT

UniProt

Q8N1K5

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with THEMIS Rabbit Polyclonal Antibody (orb331244) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001158159

Preservative

Lyophilized powder

AA Sequence

RHHVDITKKLHPNQAGLDSKVLIGSQNDLVDEEKERSNRGATAIAETFKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Texas Red® cadaverine *Single Isomer*
482-AAT 5 mg

Texas Red® cadaverine *Single Isomer*

Sign In for Pricing
View Details
Human GRIP2 activation kit by CRISPRa
GA113001 1 Kit

Human GRIP2 activation kit by CRISPRa

Sign In for Pricing
View Details
EAAC1 Antibody: ATTO 594
SMC-406D-A594 100 µg

EAAC1 Antibody: ATTO 594

Sign In for Pricing
View Details
STA13 Antibody
8C11950-AAT 50 µg

STA13 Antibody

Sign In for Pricing
View Details
IGSF5 (N-term) Rabbit Polyclonal Antibody
AP52176PU-N 400 µL

IGSF5 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
5-Phenyl-1,2,4-triazin-3-amine
TRC-P400220-50MG 50 mg

5-Phenyl-1,2,4-triazin-3-amine

Sign In for Pricing
View Details