THEMIS Peptide - C-terminal region
THEMIS Peptide - C-terminal region
Product Specifications
Product Name Alternative
C6orf190, C6orf207, FLJ40584, MGC163388, TSEPA, bA325O24.3, bA325O24.4, GASP, SPOT
UniProt
Q8N1K5
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with THEMIS Rabbit Polyclonal Antibody (orb331244) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001158159
Preservative
Lyophilized powder
AA Sequence
RHHVDITKKLHPNQAGLDSKVLIGSQNDLVDEEKERSNRGATAIAETFKN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RDR-COL9a3-Hu-01 96 Tests
Human Collagen Type IX Alpha 3 (COL9a3) ELISA Kit
Sign In for Pricing
View Details RDR-COL9a3-Hu-02 48 Tests
Human Collagen Type IX Alpha 3 (COL9a3) ELISA Kit
Sign In for Pricing
View Details 
#92287 1 Kit
Mix-n-StainTM CF®543 Antibody Labeling Kit, 1x (5-20ug) labeling
Sign In for Pricing
View Details 
BNC741649-500 1x 500 µL
CD15 / FUT4 (Reed-Sternberg Cell Marker), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 