Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFSF8 Peptide - N-terminal region

TNFSF8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD153, CD30L, CD30LG, MGC138144

UniProt

P32971

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TNFSF8 Rabbit Polyclonal Antibody (orb585770) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001235

Preservative

Lyophilized powder

AA Sequence

ATIMVLVVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCL26 Recombinant Protein
OPCD05297-200UG 200 µg

CCL26 Recombinant Protein

Sign In for Pricing
View Details
MLLT4-AS1 AAV Vector (Human) (CMV)
30209101 1 µg

MLLT4-AS1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
TFF2 Recombinant Protein
OPCD07338-50UG 50 µg

TFF2 Recombinant Protein

Sign In for Pricing
View Details
Rabbit Osteoclase differentiation factor ELISA Kit
MBS723169-01 48 Well

Rabbit Osteoclase differentiation factor ELISA Kit

Sign In for Pricing
View Details
Rabbit Osteoclase differentiation factor ELISA Kit
MBS723169-02 96 Well

Rabbit Osteoclase differentiation factor ELISA Kit

Sign In for Pricing
View Details
Rabbit Osteoclase differentiation factor ELISA Kit
MBS723169-03 5x 96 Well

Rabbit Osteoclase differentiation factor ELISA Kit

Sign In for Pricing
View Details