Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNFSF8 Peptide - N-terminal region

TNFSF8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CD153, CD30L, CD30LG, MGC138144

UniProt

P32971

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TNFSF8 Rabbit Polyclonal Antibody (orb585770) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001235

Preservative

Lyophilized powder

AA Sequence

ATIMVLVVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

F-Box Only Protein 4 (FBXO4) Antibody
abx321367-01 20 µL

F-Box Only Protein 4 (FBXO4) Antibody

Sign In for Pricing
View Details
F-Box Only Protein 4 (FBXO4) Antibody
abx321367-02 50 µL

F-Box Only Protein 4 (FBXO4) Antibody

Sign In for Pricing
View Details
F-Box Only Protein 4 (FBXO4) Antibody
abx321367-03 100 µL

F-Box Only Protein 4 (FBXO4) Antibody

Sign In for Pricing
View Details
F-Box Only Protein 4 (FBXO4) Antibody
abx321367-04 200 µL

F-Box Only Protein 4 (FBXO4) Antibody

Sign In for Pricing
View Details
F-Box Only Protein 4 (FBXO4) Antibody
abx321367-05 1 mL

F-Box Only Protein 4 (FBXO4) Antibody

Sign In for Pricing
View Details
Galk2 3'UTR GFP Stable Cell Line
TU254919 1.0 mL

Galk2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details