Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PANK2 Peptide - C-terminal region

PANK2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C20orf48, FLJ17232, HARP, HSS, MGC15053, NBIA1, PKAN

UniProt

Q9BZ23

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PANK2 Rabbit Polyclonal Antibody (orb585771) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_705902

Preservative

Lyophilized powder

AA Sequence

ERFGLPGWAVASSFGNMMSKEKREAVSKEDLARATLITITNNIGSIARMC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPK13 Adenovirus (Mouse)
28056054 1.0 mL

MAPK13 Adenovirus (Mouse)

Sign In for Pricing
View Details
Actin-Related protein 8 (ACTR8) Human ELISA Kit
B2390 96 Tests

Actin-Related protein 8 (ACTR8) Human ELISA Kit

Sign In for Pricing
View Details
CYP20A1 Protein Vector (Mouse) (pPM-C-HA)
PV169440 500 ng

CYP20A1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
NorW Antibody
orb823219 2 mg

NorW Antibody

Sign In for Pricing
View Details
PSKH1 Rabbit Polyclonal Antibody
TA308463 100 µL

PSKH1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat C2 domain-containing protein 2-like (C2CD2L) ELISA Kit
MBS7246718-01 48 Well

Rat C2 domain-containing protein 2-like (C2CD2L) ELISA Kit

Sign In for Pricing
View Details