Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PANK2 Peptide - C-terminal region

PANK2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C20orf48, FLJ17232, HARP, HSS, MGC15053, NBIA1, PKAN

UniProt

Q9BZ23

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PANK2 Rabbit Polyclonal Antibody (orb585771) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_705902

Preservative

Lyophilized powder

AA Sequence

ERFGLPGWAVASSFGNMMSKEKREAVSKEDLARATLITITNNIGSIARMC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EYA4, CT (EYA4, Eyes absent homolog 4) (Azide free) (HRP)
MBS6297255-01 0.2 mL

EYA4, CT (EYA4, Eyes absent homolog 4) (Azide free) (HRP)

Sign In for Pricing
View Details
EYA4, CT (EYA4, Eyes absent homolog 4) (Azide free) (HRP)
MBS6297255-02 5x 0.2 mL

EYA4, CT (EYA4, Eyes absent homolog 4) (Azide free) (HRP)

Sign In for Pricing
View Details
Human Alpha-type platelet-derived growth factor receptor ELISA Kit
MBS9425163-01 96 Tests

Human Alpha-type platelet-derived growth factor receptor ELISA Kit

Sign In for Pricing
View Details
Human Alpha-type platelet-derived growth factor receptor ELISA Kit
MBS9425163-02 5x 96 Tests

Human Alpha-type platelet-derived growth factor receptor ELISA Kit

Sign In for Pricing
View Details
Doublecortin (DCX) (NM_178151) Human Over-expression Lysate
LC405947 20 µg

Doublecortin (DCX) (NM_178151) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae UDP-N-acetylmuramate--L-alanine ligase (murC)
MBS1315769-01 0.02 mg (E-Coli)

Recombinant Haemophilus influenzae UDP-N-acetylmuramate--L-alanine ligase (murC)

Sign In for Pricing
View Details