Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LILRB2 Peptide - C-terminal region

LILRB2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD85D, ILT4, LILRA6, LIR-2, LIR2, MIR-10, MIR10

UniProt

Q8N423

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LILRB2 Rabbit Polyclonal Antibody (orb585807) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005865

Preservative

Lyophilized powder

AA Sequence

MDTRAAASEAPQDVTYAQLHSLTLRRKATEPPPSQEREPPAEPSIYATLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Araloside V
MBS3840632-01 10 mg

Araloside V

Sign In for Pricing
View Details
Araloside V
MBS3840632-02 25 mg

Araloside V

Sign In for Pricing
View Details
Araloside V
MBS3840632-03 50 mg

Araloside V

Sign In for Pricing
View Details
Araloside V
MBS3840632-04 5x 50 mg

Araloside V

Sign In for Pricing
View Details
2-Bromo-5-iodopyridine ≥97% (HPLC)
230010-01 1 g

2-Bromo-5-iodopyridine ≥97% (HPLC)

Sign In for Pricing
View Details
2-Bromo-5-iodopyridine ≥97% (HPLC)
230010-02 5 g

2-Bromo-5-iodopyridine ≥97% (HPLC)

Sign In for Pricing
View Details