LILRB2 Peptide - C-terminal region
LILRB2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CD85D, ILT4, LILRA6, LIR-2, LIR2, MIR-10, MIR10
UniProt
Q8N423
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LILRB2 Rabbit Polyclonal Antibody (orb585807) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005865
Preservative
Lyophilized powder
AA Sequence
MDTRAAASEAPQDVTYAQLHSLTLRRKATEPPPSQEREPPAEPSIYATLA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6473937-01 0.2 mL
eNos, Phosphorylated (Ser1177) (Nitric Oxide Synthase, Endothelial, Endothelial NOS, eNOS, EC-NOS, NOS Type III, NOSIII, Constitutive NOS, cNOS, NOS3) (AP)
Sign In for Pricing
View Details MBS6473937-02 5x 0.2 mL
eNos, Phosphorylated (Ser1177) (Nitric Oxide Synthase, Endothelial, Endothelial NOS, eNOS, EC-NOS, NOS Type III, NOSIII, Constitutive NOS, cNOS, NOS3) (AP)
Sign In for Pricing
View Details K0602705 3x 1.0 µg
DIMT1L sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details 