Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD276 Peptide - C-terminal region

CD276 Peptide - C-terminal region

Product Specifications

Product Name Alternative

B7-H3, B7H3, B7RP-2, 4Ig-B7-H3

UniProt

Q5ZPR3

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD276 Rabbit Polyclonal Antibody (orb585812) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079516

Preservative

Lyophilized powder

AA Sequence

VCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mafg (BC002092) Mouse Tagged ORF Clone
MG201268 10 µg

Mafg (BC002092) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
LMO2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C8]
TA506139BM 100 µL

LMO2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C8]

Sign In for Pricing
View Details
INSYN1 (NM_001039614) Human Over-expression Lysate
LC422090 20 µg

INSYN1 (NM_001039614) Human Over-expression Lysate

Sign In for Pricing
View Details
GW0742 Sulfone
TRC-G930005-1MG 1 mg

GW0742 Sulfone

Sign In for Pricing
View Details
CD5 (C5/473 + CD5/54/F6), CF740 conjugate, 0.1mg/mL
BNC740748-500 1x 500 µL

CD5 (C5/473 + CD5/54/F6), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Isoguanine
TRC-I819000-500MG 500 mg

Isoguanine

Sign In for Pricing
View Details