Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD276 Peptide - C-terminal region

CD276 Peptide - C-terminal region

Product Specifications

Product Name Alternative

B7-H3, B7H3, B7RP-2, 4Ig-B7-H3

UniProt

Q5ZPR3

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD276 Rabbit Polyclonal Antibody (orb585812) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079516

Preservative

Lyophilized powder

AA Sequence

VCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thyroid Hormone Receptor beta (THRB) (NM_000461) Human Over-expression Lysate
LC400163 20 µg

Thyroid Hormone Receptor beta (THRB) (NM_000461) Human Over-expression Lysate

Sign In for Pricing
View Details
Human KREMEN2 activation kit by CRISPRa
GA112439 1 Kit

Human KREMEN2 activation kit by CRISPRa

Sign In for Pricing
View Details
MALT1 Mouse Monoclonal Antibody [Clone ID: OTI3A2]
CF807311 100 µg

MALT1 Mouse Monoclonal Antibody [Clone ID: OTI3A2]

Sign In for Pricing
View Details
EGFR (31G7), CF488A conjugate, 0.1mg/mL
BNC881194-100 1x 100 µL

EGFR (31G7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BCL10 Polyclonal Antibody
E-AB-14787-01 20 µL

BCL10 Polyclonal Antibody

Sign In for Pricing
View Details
BCL10 Polyclonal Antibody
E-AB-14787-02 60 µL

BCL10 Polyclonal Antibody

Sign In for Pricing
View Details