FUT3 Peptide - C-terminal region
FUT3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CD174, FT3B, FucT-III, LE, Les, MGC131739
UniProt
P21217
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FUT3 Rabbit Polyclonal Antibody (orb585816) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_000140
Preservative
Lyophilized powder
AA Sequence
DKDHARYLSYFRWRETLRPRSFSWALDFCKACWKLQQESRYQTVRSIAAW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940679-100 1x 100 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740676-500 1x 500 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470218-500 1x 500 µL
CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details