Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxa6 Peptide - N-terminal region

Hoxa6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Hox-1.2

UniProt

P09092

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hoxa6 Rabbit Polyclonal Antibody (orb574305) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034584

Preservative

Lyophilized powder

AA Sequence

SSYFVNPTFPGSLPSGQDSFLGQLPLYPAGYDALRPFPASYGASSLPDKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRPM1 (NM_002420) Human Over-expression Lysate
LY419339 100 µg

TRPM1 (NM_002420) Human Over-expression Lysate

Sign In for Pricing
View Details
Phospho-heterochromatin protein 1 (pTyr24) Rabbit Polyclonal Antibody (PerCP)
orb2555659 100 µL

Phospho-heterochromatin protein 1 (pTyr24) Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
S100A9 (47-8D3), Biotin conjugate, 0.1mg/mL
BNCB1093-500 1x 500 µL

S100A9 (47-8D3), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti-Mouse Fc epsilon Receptor I alpha (FceR1) PE
MBS697300-01 0.025 mg

Anti-Mouse Fc epsilon Receptor I alpha (FceR1) PE

Sign In for Pricing
View Details
Anti-Mouse Fc epsilon Receptor I alpha (FceR1) PE
MBS697300-02 0.1 mg

Anti-Mouse Fc epsilon Receptor I alpha (FceR1) PE

Sign In for Pricing
View Details
Anti-Mouse Fc epsilon Receptor I alpha (FceR1) PE
MBS697300-03 5x 0.1 mg

Anti-Mouse Fc epsilon Receptor I alpha (FceR1) PE

Sign In for Pricing
View Details