Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxa6 Peptide - N-terminal region

Hoxa6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Hox-1.2

UniProt

P09092

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hoxa6 Rabbit Polyclonal Antibody (orb574305) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034584

Preservative

Lyophilized powder

AA Sequence

SSYFVNPTFPGSLPSGQDSFLGQLPLYPAGYDALRPFPASYGASSLPDKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Epidermal growth factor receptor ELISA kit
GTR10379024 96 Well

Bovine Epidermal growth factor receptor ELISA kit

Sign In for Pricing
View Details
SIAH3 Antibody - C-terminal region : Biotin (ARP69563_P050-Biotin)
ARP69563_P050-Biotin 100 µL

SIAH3 Antibody - C-terminal region : Biotin (ARP69563_P050-Biotin)

Sign In for Pricing
View Details
GSTA1 293 Cell Lysate
404398 0.1 mg

GSTA1 293 Cell Lysate

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Cadherin EGF LAG Seven Pass G-Type Receptor 3 (CELSR3)
MBS2078060-01 0.1 mL

APC-Linked Polyclonal Antibody to Cadherin EGF LAG Seven Pass G-Type Receptor 3 (CELSR3)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Cadherin EGF LAG Seven Pass G-Type Receptor 3 (CELSR3)
MBS2078060-02 0.2 mL

APC-Linked Polyclonal Antibody to Cadherin EGF LAG Seven Pass G-Type Receptor 3 (CELSR3)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Cadherin EGF LAG Seven Pass G-Type Receptor 3 (CELSR3)
MBS2078060-03 0.5 mL

APC-Linked Polyclonal Antibody to Cadherin EGF LAG Seven Pass G-Type Receptor 3 (CELSR3)

Sign In for Pricing
View Details