Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM63A Peptide - C-terminal region

TMEM63A Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA0489, KIAA0792

UniProt

O94886

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMEM63A Rabbit Polyclonal Antibody (orb324899) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055513

Preservative

Lyophilized powder

AA Sequence

FLVLLLTILVCLAHTCFGCFKHLSPLNYKTEEPASDKGSEAEAHMPPPFT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBP (A-6)
sc-74595 200 µg/mL

TBP (A-6)

Sign In for Pricing
View Details
Rat 6-keto-prostaglandin ELISA Kit
MBS721250-01 48 Well

Rat 6-keto-prostaglandin ELISA Kit

Sign In for Pricing
View Details
Rat 6-keto-prostaglandin ELISA Kit
MBS721250-02 96 Well

Rat 6-keto-prostaglandin ELISA Kit

Sign In for Pricing
View Details
Rat 6-keto-prostaglandin ELISA Kit
MBS721250-03 5x 96 Well

Rat 6-keto-prostaglandin ELISA Kit

Sign In for Pricing
View Details
Rat 6-keto-prostaglandin ELISA Kit
MBS721250-04 10x 96 Well

Rat 6-keto-prostaglandin ELISA Kit

Sign In for Pricing
View Details
Tn Antigen Antibody
ANT-37088-100ug 100 µg

Tn Antigen Antibody

Sign In for Pricing
View Details