Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ESAM Peptide - N-terminal region

ESAM Peptide - N-terminal region

Product Specifications

Product Name Alternative

W117m

UniProt

Q96AP7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ESAM Rabbit Polyclonal Antibody (orb578654) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_620411

Preservative

Lyophilized powder

AA Sequence

VTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLPAWYTLHG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEAT1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
31673111 3x 1.0 µg

NEAT1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
RL23A rabbit pAb
UB-GEN-9111 100 µL

RL23A rabbit pAb

Sign In for Pricing
View Details
Lentiviral mouse Vmn1r226 shRNA (UAS) - Lentiviral mouse Vmn1r226 shRNA (UAS, GFP) (100)
GTR15139689 1 Vial

Lentiviral mouse Vmn1r226 shRNA (UAS) - Lentiviral mouse Vmn1r226 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Erk5 (D3I5V) Rabbit Monoclonal Antibody
CST 12950T 20 µL

Erk5 (D3I5V) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ORF59 (NC_001348) Virus Tagged ORF Clone
VC101000 10 µg

ORF59 (NC_001348) Virus Tagged ORF Clone

Sign In for Pricing
View Details
Tetraethylene glycol monohexadecyl ether
MBS5800822 Inquire

Tetraethylene glycol monohexadecyl ether

Sign In for Pricing
View Details