Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2E1 Peptide - N-terminal region

UBE2E1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

UBCH6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UBE2E1 Rabbit Polyclonal Antibody (orb578847) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_872607

Preservative

Lyophilized powder

AA Sequence

ETNTPKKKESKVSMSKNSKLLSTSAKSAGPKGDNIYEWRSTILGPPGSVY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thymidine Kinase 1/TK1 Blocking Peptide
MBS9618687-01 1 mg

Thymidine Kinase 1/TK1 Blocking Peptide

Sign In for Pricing
View Details
Thymidine Kinase 1/TK1 Blocking Peptide
MBS9618687-02 5x 1 mg

Thymidine Kinase 1/TK1 Blocking Peptide

Sign In for Pricing
View Details
Indoleamine 2,3-dioxygenase Recombinant Rabbit mAb
orb2325404-01 25 µL

Indoleamine 2,3-dioxygenase Recombinant Rabbit mAb

Sign In for Pricing
View Details
Indoleamine 2,3-dioxygenase Recombinant Rabbit mAb
orb2325404-02 50 µL

Indoleamine 2,3-dioxygenase Recombinant Rabbit mAb

Sign In for Pricing
View Details
Indoleamine 2,3-dioxygenase Recombinant Rabbit mAb
orb2325404-03 100 µL

Indoleamine 2,3-dioxygenase Recombinant Rabbit mAb

Sign In for Pricing
View Details
PAK1 Rabbit Polyclonal Antibody (HRP)
orb482745 100 µL

PAK1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details