Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Uba5 Peptide - N-terminal region

Uba5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

5730525G14Rik, AW240750, Ube1dc1

UniProt

Q8VE47

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Uba5 Rabbit Polyclonal Antibody (orb580902) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079968

Preservative

Lyophilized powder

AA Sequence

LLFDYDKVELANMNRLFFQPYQAGLSKVHAAEHTLRNINPDVLFEVHNYN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ST6GAL1 Protein (His Tag)
PKSH033362-01 10 µg

Recombinant Human ST6GAL1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human ST6GAL1 Protein (His Tag)
PKSH033362-02 50 µg

Recombinant Human ST6GAL1 Protein (His Tag)

Sign In for Pricing
View Details
Hmgb2 (BC046759) Mouse Tagged ORF Clone
MG202266 10 µg

Hmgb2 (BC046759) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
PE/Cyanine7 Mouse IgG2b, κ Isotype Control[MPC-11]
E-AB-F09813H-01 25 µg

PE/Cyanine7 Mouse IgG2b, κ Isotype Control[MPC-11]

Sign In for Pricing
View Details
PE/Cyanine7 Mouse IgG2b, κ Isotype Control[MPC-11]
E-AB-F09813H-02 100 µg

PE/Cyanine7 Mouse IgG2b, κ Isotype Control[MPC-11]

Sign In for Pricing
View Details
CD6 (C6/372), CF640R conjugate, 0.1mg/mL
BNC400372-500 1x 500 µL

CD6 (C6/372), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details