Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Uba5 Peptide - N-terminal region

Uba5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

5730525G14Rik, AW240750, Ube1dc1

UniProt

Q8VE47

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Uba5 Rabbit Polyclonal Antibody (orb580902) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079968

Preservative

Lyophilized powder

AA Sequence

LLFDYDKVELANMNRLFFQPYQAGLSKVHAAEHTLRNINPDVLFEVHNYN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Venetoclax Impurity S1A
TRC-V121040-50MG 50 mg

Venetoclax Impurity S1A

Sign In for Pricing
View Details
Human ZNF436 activation kit by CRISPRa
GA112988 1 Kit

Human ZNF436 activation kit by CRISPRa

Sign In for Pricing
View Details
Sodium Glycolate
TRC-S090900-250G 250 g

Sodium Glycolate

Sign In for Pricing
View Details
MYO1D Antibody
8C16783-AAT 50 µg

MYO1D Antibody

Sign In for Pricing
View Details
TMX3 Rabbit Polyclonal Antibody
TA370754 100 µL

TMX3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Polystyrene C4 Br
HB04508001.100G 100 g

Polystyrene C4 Br

Sign In for Pricing
View Details