Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wasf2 Peptide - middle region

Wasf2 Peptide - middle region

Product Specifications

Product Name Alternative

AW742646, D4Ertd13e, WAVE2

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Wasf2 Rabbit Polyclonal Antibody (orb581348) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_700472

Preservative

Lyophilized powder

AA Sequence

QNGSIGSVENVDAASYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPADN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pig KITLG Matched Antibody Pair Set [ABP-S-052042]
ABP-S-052042 5 Plates

Pig KITLG Matched Antibody Pair Set [ABP-S-052042]

Sign In for Pricing
View Details
CCL22 siRNA (Human)
MBS8215284-01 15 nmol

CCL22 siRNA (Human)

Sign In for Pricing
View Details
CCL22 siRNA (Human)
MBS8215284-02 30 nmol

CCL22 siRNA (Human)

Sign In for Pricing
View Details
CCL22 siRNA (Human)
MBS8215284-03 5x 30 nmol

CCL22 siRNA (Human)

Sign In for Pricing
View Details
NAP1L6 sgRNA CRISPR Lentivector (Human) (Target 2)
K1390303 1.0 µg DNA

NAP1L6 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Topoisomerase II alpha (Proliferation & Drug-Resistance Marker) (TOP2A/1362), Biotin conjugate, 0.1mg/mL
BNCB1362-100 1x 100 µL

Topoisomerase II alpha (Proliferation & Drug-Resistance Marker) (TOP2A/1362), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details