Wasf2 Peptide - middle region
Wasf2 Peptide - middle region
Product Specifications
Product Name Alternative
AW742646, D4Ertd13e, WAVE2
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Wasf2 Rabbit Polyclonal Antibody (orb581348) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_700472
Preservative
Lyophilized powder
AA Sequence
QNGSIGSVENVDAASYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPADN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog