Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wasf2 Peptide - middle region

Wasf2 Peptide - middle region

Product Specifications

Product Name Alternative

AW742646, D4Ertd13e, WAVE2

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Wasf2 Rabbit Polyclonal Antibody (orb581348) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_700472

Preservative

Lyophilized powder

AA Sequence

QNGSIGSVENVDAASYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPADN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B3galt1 ORF Vector (Rat) (pORF)
ORF063904 1.0 µg DNA

B3galt1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Baclofen Impurity 65
RM-B011265-01 10 mg

Baclofen Impurity 65

Sign In for Pricing
View Details
Baclofen Impurity 65
RM-B011265-02 100 mg

Baclofen Impurity 65

Sign In for Pricing
View Details
Baclofen Impurity 65
RM-B011265-03 25 mg

Baclofen Impurity 65

Sign In for Pricing
View Details
Baclofen Impurity 65
RM-B011265-04 50 mg

Baclofen Impurity 65

Sign In for Pricing
View Details
Recombinant Human Hydroperoxide isomerase ALOXE3 (ALOXE3)
orb1785555-01 20 µg

Recombinant Human Hydroperoxide isomerase ALOXE3 (ALOXE3)

Sign In for Pricing
View Details