Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dbf4 Peptide - C-terminal region

Dbf4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AA545217, Ask

UniProt

Q9QZ41

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dbf4 Rabbit Polyclonal Antibody (orb581633) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001177646

Preservative

Lyophilized powder

AA Sequence

AELDKKRTEYLPAHEDRTCGSPVQSLLDLFQTSEEKSEFLGFTGYTENSG

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Zfp958 shRNA (UAS) - Lentiviral mouse Zfp958 shRNA (UAS) (100)
GTR15201150 1 Vial

Lentiviral mouse Zfp958 shRNA (UAS) - Lentiviral mouse Zfp958 shRNA (UAS) (100)

Sign In for Pricing
View Details
4-Nitrohippuric acid
sc-226762C 100 g

4-Nitrohippuric acid

Sign In for Pricing
View Details
Transglutaminase 3, Epidermal (TGM3) Magnetic Luminex Assay Kit
LKU606331 96 Tests

Transglutaminase 3, Epidermal (TGM3) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
Recombinant Cat Cathepsin L1 (CTSL1)
MBS960143-01 0.02 mg (E-Coli)

Recombinant Cat Cathepsin L1 (CTSL1)

Sign In for Pricing
View Details
Recombinant Cat Cathepsin L1 (CTSL1)
MBS960143-02 0.1 mg (E-Coli)

Recombinant Cat Cathepsin L1 (CTSL1)

Sign In for Pricing
View Details
Recombinant Cat Cathepsin L1 (CTSL1)
MBS960143-03 0.02 mg (Yeast)

Recombinant Cat Cathepsin L1 (CTSL1)

Sign In for Pricing
View Details