Dbf4 Peptide - C-terminal region
Dbf4 Peptide - C-terminal region
Product Specifications
Product Name Alternative
AA545217, Ask
UniProt
Q9QZ41
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Dbf4 Rabbit Polyclonal Antibody (orb581633) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001177646
Preservative
Lyophilized powder
AA Sequence
AELDKKRTEYLPAHEDRTCGSPVQSLLDLFQTSEEKSEFLGFTGYTENSG
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2905818-01 48 Well
Mouse Kcnq2 / Potassium voltage-gated channel subfamily KQT member 2 ELISA Kit
Sign In for Pricing
View Details 
MBS2905818-02 96 Well
Mouse Kcnq2 / Potassium voltage-gated channel subfamily KQT member 2 ELISA Kit
Sign In for Pricing
View Details 
MBS2905818-03 5x 96 Well
Mouse Kcnq2 / Potassium voltage-gated channel subfamily KQT member 2 ELISA Kit
Sign In for Pricing
View Details 
MBS2905818-04 10x 96 Well
Mouse Kcnq2 / Potassium voltage-gated channel subfamily KQT member 2 ELISA Kit
Sign In for Pricing
View Details TL307145V 500 µL Each
RBM47 Human shRNA Lentiviral Particle (Locus ID 54502)
Sign In for Pricing
View Details