Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ccnj Peptide - C-terminal region

Ccnj Peptide - C-terminal region

Product Specifications

UniProt

D4A1H5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ccnj Rabbit Polyclonal Antibody (orb583529) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099839

Preservative

Lyophilized powder

AA Sequence

PAGFQTSVQGLGHMQTGVGMSLAIPVEVKPCLSVSYNRSYQINEHFPCIT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARL6-set siRNA/shRNA/RNAi Lentivector (Human)
12397091 4x 500 ng

ARL6-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Desmethyl ofloxacin
FD21301-01 10 mg

Desmethyl ofloxacin

Sign In for Pricing
View Details
Desmethyl ofloxacin
FD21301-02 25 mg

Desmethyl ofloxacin

Sign In for Pricing
View Details
pDNR-LIB-Tdrkh Plasmid
PVT42000 2 µg

pDNR-LIB-Tdrkh Plasmid

Sign In for Pricing
View Details
FBXW7 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10B9]
TA802871BM 100 µL

FBXW7 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI10B9]

Sign In for Pricing
View Details
Magnetic separation of CD44 Positive Cells (only Magnetic Beads)
STEM55 10 Reactions

Magnetic separation of CD44 Positive Cells (only Magnetic Beads)

Sign In for Pricing
View Details