Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ccnj Peptide - C-terminal region

Ccnj Peptide - C-terminal region

Product Specifications

UniProt

D4A1H5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ccnj Rabbit Polyclonal Antibody (orb583529) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099839

Preservative

Lyophilized powder

AA Sequence

PAGFQTSVQGLGHMQTGVGMSLAIPVEVKPCLSVSYNRSYQINEHFPCIT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFKB1p105 Antibody
MBS9403062-01 0.1 mL

NFKB1p105 Antibody

Sign In for Pricing
View Details
NFKB1p105 Antibody
MBS9403062-02 5x 0.1 mL

NFKB1p105 Antibody

Sign In for Pricing
View Details
Regn7075 (Anti-CD28 & EGFR)
C00902-1mg 1 mg

Regn7075 (Anti-CD28 & EGFR)

Sign In for Pricing
View Details
INSL4 Polyclonal Antibody, FITC Conjugated
A64800-100 100 µL

INSL4 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
Barttin CRISPR/Cas9 KO Plasmid (m)
sc-431205 20 µg

Barttin CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
GINS4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0858608 1.0 µg DNA

GINS4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details