Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INKA2 Peptide - middle region

INKA2 Peptide - middle region

Product Specifications

Product Name Alternative

Fam212b, RGD1306526

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INKA2 Rabbit Polyclonal Antibody (orb326235) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101183

Preservative

Lyophilized powder

AA Sequence

DNVFADLVGNWLDLPELEKGGERGETGGSGEPKGEKGQSRELGRKFALTA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lipase, Endothelial (LIPG) Magnetic Luminex Assay Kit
LKU604829 96 Tests

Lipase, Endothelial (LIPG) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
Zfp238 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3948904 1.0 µg DNA

Zfp238 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
SfsA Antibody
orb832224 2 mg

SfsA Antibody

Sign In for Pricing
View Details
2-Thiobarbituric acid
34943527-25g 25 g

2-Thiobarbituric acid

Sign In for Pricing
View Details
Research Grade Anti-Human MAPT/Tau/PHF-tau (PNT001)
HY086086-01 100 µg

Research Grade Anti-Human MAPT/Tau/PHF-tau (PNT001)

Sign In for Pricing
View Details
Research Grade Anti-Human MAPT/Tau/PHF-tau (PNT001)
HY086086-02 1 mg

Research Grade Anti-Human MAPT/Tau/PHF-tau (PNT001)

Sign In for Pricing
View Details