Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INKA2 Peptide - middle region

INKA2 Peptide - middle region

Product Specifications

Product Name Alternative

Fam212b, RGD1306526

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INKA2 Rabbit Polyclonal Antibody (orb326235) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101183

Preservative

Lyophilized powder

AA Sequence

DNVFADLVGNWLDLPELEKGGERGETGGSGEPKGEKGQSRELGRKFALTA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

10- (4-Methoxyphenyl) -10H-phenothiazine
OR1078899-01 1 g

10- (4-Methoxyphenyl) -10H-phenothiazine

Sign In for Pricing
View Details
10- (4-Methoxyphenyl) -10H-phenothiazine
OR1078899-02 5 g

10- (4-Methoxyphenyl) -10H-phenothiazine

Sign In for Pricing
View Details
Human S100A11 (S100 Calcium Binding Protein A11) ELISA Kit
ELK10242-01 48 Tests

Human S100A11 (S100 Calcium Binding Protein A11) ELISA Kit

Sign In for Pricing
View Details
Human S100A11 (S100 Calcium Binding Protein A11) ELISA Kit
ELK10242-02 96 Tests

Human S100A11 (S100 Calcium Binding Protein A11) ELISA Kit

Sign In for Pricing
View Details
Human S100A11 (S100 Calcium Binding Protein A11) ELISA Kit
ELK10242-03 5x 96 Tests

Human S100A11 (S100 Calcium Binding Protein A11) ELISA Kit

Sign In for Pricing
View Details
Anti-TNF-alphalpha (Tumor Necrosis Factor alpha) Monoclonal Antibody (Clone: MAb1)
36-3281-100 100 µg

Anti-TNF-alphalpha (Tumor Necrosis Factor alpha) Monoclonal Antibody (Clone: MAb1)

Sign In for Pricing
View Details