Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hsp90ab1 Peptide - N-terminal region

Hsp90ab1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

90kDa, AL022974, C81438, Hsp84, Hsp84-1, Hsp90, Hspcb, MGC115780

UniProt

P11499

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hsp90ab1 Rabbit Polyclonal Antibody (orb584136) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032328

Preservative

Lyophilized powder

AA Sequence

NASDALDKIRYESLTDPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Dedicator Of Cytokinesis 5 (DOCK5)
TRV-0045125-01 10 µg

Recombinant Dedicator Of Cytokinesis 5 (DOCK5)

Sign In for Pricing
View Details
Recombinant Dedicator Of Cytokinesis 5 (DOCK5)
TRV-0045125-02 50 µg

Recombinant Dedicator Of Cytokinesis 5 (DOCK5)

Sign In for Pricing
View Details
Recombinant Dedicator Of Cytokinesis 5 (DOCK5)
TRV-0045125-03 100 µg

Recombinant Dedicator Of Cytokinesis 5 (DOCK5)

Sign In for Pricing
View Details
Recombinant Dedicator Of Cytokinesis 5 (DOCK5)
TRV-0045125-04 200 µg

Recombinant Dedicator Of Cytokinesis 5 (DOCK5)

Sign In for Pricing
View Details
Recombinant Dedicator Of Cytokinesis 5 (DOCK5)
TRV-0045125-05 500 µg

Recombinant Dedicator Of Cytokinesis 5 (DOCK5)

Sign In for Pricing
View Details
Recombinant Dedicator Of Cytokinesis 5 (DOCK5)
TRV-0045125-06 1 mg

Recombinant Dedicator Of Cytokinesis 5 (DOCK5)

Sign In for Pricing
View Details