Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ubxn6 Peptide - middle region

Ubxn6 Peptide - middle region

Product Specifications

Product Name Alternative

1200008L11Rik, 2210415J11Rik, AU040909, Ubxd1, Ubxdc2

UniProt

Q99PL6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ubxn6 Rabbit Polyclonal Antibody (orb584286) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077752

Preservative

Lyophilized powder

AA Sequence

KREQRLRTEAVERLSSLRTKAMREKEEQRELRKYTYALVRVRLPDGCLLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Acid Phosphatase 2 (ACP2) ELISA Kit
YP-W18286-01 48 Tests

Human Acid Phosphatase 2 (ACP2) ELISA Kit

Sign In for Pricing
View Details
Human Acid Phosphatase 2 (ACP2) ELISA Kit
YP-W18286-02 96 Tests

Human Acid Phosphatase 2 (ACP2) ELISA Kit

Sign In for Pricing
View Details
Leo1 Antibody - N-terminal region : HRP (ARP52637_P050-HRP)
ARP52637_P050-HRP 100 µL

Leo1 Antibody - N-terminal region : HRP (ARP52637_P050-HRP)

Sign In for Pricing
View Details
Rabbit Polyclonal SAH3 Antibody [Alexa Fluor 532]
NBP2-98616AF532 0.1 mL

Rabbit Polyclonal SAH3 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
Human Fetal Hemoglobin HBF ELISA Kit
BG-HUM11210-01 1 Each

Human Fetal Hemoglobin HBF ELISA Kit

Sign In for Pricing
View Details
Human Fetal Hemoglobin HBF ELISA Kit
BG-HUM11210-02 1 Each

Human Fetal Hemoglobin HBF ELISA Kit

Sign In for Pricing
View Details