Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ubxn6 Peptide - middle region

Ubxn6 Peptide - middle region

Product Specifications

Product Name Alternative

1200008L11Rik, 2210415J11Rik, AU040909, Ubxd1, Ubxdc2

UniProt

Q99PL6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ubxn6 Rabbit Polyclonal Antibody (orb584286) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077752

Preservative

Lyophilized powder

AA Sequence

KREQRLRTEAVERLSSLRTKAMREKEEQRELRKYTYALVRVRLPDGCLLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD239 discontinued
347077-01 100 µL

CD239 discontinued

Sign In for Pricing
View Details
CD239 discontinued
347077-02 200 µL

CD239 discontinued

Sign In for Pricing
View Details
IQCH Protein Lysate (Mouse) with C-HA Tag
25059034 100 µg

IQCH Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Sheep Zinc finger protein 326 (ZNF326) ELISA Kit
OM624016 96 Strip Well

Sheep Zinc finger protein 326 (ZNF326) ELISA Kit

Sign In for Pricing
View Details
IQCB1 Antibody
MBS9506472-01 0.05 mL

IQCB1 Antibody

Sign In for Pricing
View Details
IQCB1 Antibody
MBS9506472-02 0.1 mL

IQCB1 Antibody

Sign In for Pricing
View Details