Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ablim1 Peptide - middle region

Ablim1 Peptide - middle region

Product Specifications

Product Name Alternative

2210411C18Rik, 2610209L21Rik, 4833406P10Rik, 9330196J19Rik, AV079770, AW060987, AW215784, Limab1, abLIM-L, abLIM-M, abLIM-S, mKIAA0059, 9330196J19

UniProt

E9Q030

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ablim1 Rabbit Polyclonal Antibody (orb584448) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001096648

Preservative

Lyophilized powder

AA Sequence

KAIYDIERPDLITYEPFYTSGYEDKQERQSLGESPRTLSPTPSAEGYQDV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-(n-Butyl)phosphoric Triamide
TRC-B693650-250MG 250 mg

N-(n-Butyl)phosphoric Triamide

Sign In for Pricing
View Details
MAP2K1 Protein Vector (Human) (pPM-C-HA)
PV093104 500 ng

MAP2K1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Desmin (DES, CMD1I, CSM1, CSM2, FLJ12025, FLJ39719, FLJ41013, FLJ41793, Intermediate Filament Protein) (MaxLight 550) discontinued
D3221-03-ML550 100 µL

Desmin (DES, CMD1I, CSM1, CSM2, FLJ12025, FLJ39719, FLJ41013, FLJ41793, Intermediate Filament Protein) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Collagen V α3 Antibody
orb194109-01 50 μL

Collagen V α3 Antibody

Sign In for Pricing
View Details
Collagen V α3 Antibody
orb194109-02 100 µL

Collagen V α3 Antibody

Sign In for Pricing
View Details
Human Neuroblastoma suppressor of tumorigenicity 1 (NBL1) ELISA kit
CSB-EL015485HU-01 48 Tests

Human Neuroblastoma suppressor of tumorigenicity 1 (NBL1) ELISA kit

Sign In for Pricing
View Details