Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ablim1 Peptide - middle region

Ablim1 Peptide - middle region

Product Specifications

Product Name Alternative

2210411C18Rik, 2610209L21Rik, 4833406P10Rik, 9330196J19Rik, AV079770, AW060987, AW215784, Limab1, abLIM-L, abLIM-M, abLIM-S, mKIAA0059, 9330196J19

UniProt

E9Q030

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ablim1 Rabbit Polyclonal Antibody (orb584448) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001096648

Preservative

Lyophilized powder

AA Sequence

KAIYDIERPDLITYEPFYTSGYEDKQERQSLGESPRTLSPTPSAEGYQDV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MED19 Rabbit Polyclonal Antibody
TA330946 100 µL

MED19 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAPT / TAU (1-352, His-tag) Human Protein
AR09583PU-L 250 µg

MAPT / TAU (1-352, His-tag) Human Protein

Sign In for Pricing
View Details
CD68 Mouse mAb
orb1924341-01 50 µL

CD68 Mouse mAb

Sign In for Pricing
View Details
CD68 Mouse mAb
orb1924341-02 100 µL

CD68 Mouse mAb

Sign In for Pricing
View Details
COL19A1 Antibody
MBS8513083-01 0.05 mg

COL19A1 Antibody

Sign In for Pricing
View Details
COL19A1 Antibody
MBS8513083-02 0.1 mg

COL19A1 Antibody

Sign In for Pricing
View Details