Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cthrc1 Peptide - C-terminal region

Cthrc1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1110014B07Rik

UniProt

Q9D1D6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cthrc1 Rabbit Polyclonal Antibody (orb584486) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_081054

Preservative

Lyophilized powder

AA Sequence

HRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ticagrelor
TRC-T437700-50MG 50 mg

Ticagrelor

Sign In for Pricing
View Details
SOAT2 Double Nickase Plasmid (m)
sc-432416-NIC 20 µg

SOAT2 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
XFD700 Anti-human CD21 Antibody *HI21a*
102101A0-AAT 100 Tests

XFD700 Anti-human CD21 Antibody *HI21a*

Sign In for Pricing
View Details
Recombinant Human MMP9 Protein
CRP1970-01 10 µg

Recombinant Human MMP9 Protein

Sign In for Pricing
View Details
Recombinant Human MMP9 Protein
CRP1970-02 50 µg

Recombinant Human MMP9 Protein

Sign In for Pricing
View Details
Recombinant Human MMP9 Protein
CRP1970-03 500 µg

Recombinant Human MMP9 Protein

Sign In for Pricing
View Details