Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aplnr Peptide - C-terminal region

Aplnr Peptide - C-terminal region

Product Specifications

Product Name Alternative

APJ, Agtrl1, msr/apj

UniProt

Q9WV08

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Aplnr Rabbit Polyclonal Antibody (orb584535) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035914

Preservative

Lyophilized powder

AA Sequence

CCDQSGCKGTPHSSSAEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carbocisteine
TRC-C178760-5G 5 g

Carbocisteine

Sign In for Pricing
View Details
Visible Spectrophotometer BSSBV-303-PC
BSSBV-303-PC Each

Visible Spectrophotometer BSSBV-303-PC

Sign In for Pricing
View Details
Hbb-b2 (BC032264) Mouse Over-expression Lysate
LC700989 20 µg

Hbb-b2 (BC032264) Mouse Over-expression Lysate

Sign In for Pricing
View Details
Wilm s Tumor 1 (WT1) (Wilm s Tumor & Mesothelial Marker) (rWT1/857), CF647 conjugate, 0.1mg/mL
BNC471856-500 1x 500 µL

Wilm s Tumor 1 (WT1) (Wilm s Tumor & Mesothelial Marker) (rWT1/857), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTL10 (NM_001024675) Human Over-expression Lysate
LY422532 100 µg

ACTL10 (NM_001024675) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Ileum
CS642431 5x 5 µm

Frozen Tissue Sections, Ileum

Sign In for Pricing
View Details