Aplnr Peptide - C-terminal region
Aplnr Peptide - C-terminal region
Product Specifications
Product Name Alternative
APJ, Agtrl1, msr/apj
UniProt
Q9WV08
Field of Research
Cardiovascular Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Aplnr Rabbit Polyclonal Antibody (orb584535) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_035914
Preservative
Lyophilized powder
AA Sequence
CCDQSGCKGTPHSSSAEKSASYSSGHSQGPGPNMGKGGEQMHEKSIPYSQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC472961-100 1x 100 µL
C1QB / Complement C1q B-Chain (C1QB/2961), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![acidic Cytokeratin Mouse Monoclonal Antibody [Clone ID: SPM115]](https://cdn.genprice.uk/products/937/68dd189e061270361e8fd4cb/imageurl/am33271pu-t.webp)
AM33271PU-T 20 µg
acidic Cytokeratin Mouse Monoclonal Antibody [Clone ID: SPM115]
Sign In for Pricing
View Details 
BNUB2362-500 1x 500 µL
GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/2362), 0.2mg/mL
Sign In for Pricing
View Details