Fabp5 Peptide - C-terminal region
Fabp5 Peptide - C-terminal region
Product Specifications
Product Name Alternative
Klbp, mal1
UniProt
Q05816
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Fabp5 Rabbit Polyclonal Antibody (orb584557) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_034764
Preservative
Lyophilized powder
AA Sequence
RKTETVCTFQDGALVQHQQWDGKESTITRKLKDGKMIVECVMNNATCTRV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC942806-100 1x 100 µL
MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (MMP3/2806), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
GM-401-10 1 mL
Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Rat IgG2a, 10nm
Sign In for Pricing
View Details 
![Myeloid specific antigen Mouse Monoclonal Antibody [Clone ID: SPM298]](https://cdn.genprice.uk/products/937/68dd189e061270361e8fd4e5/imageurl/am33284pu-s.webp)
AM33284PU-S 100 µg
Myeloid specific antigen Mouse Monoclonal Antibody [Clone ID: SPM298]
Sign In for Pricing
View Details