Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fabp5 Peptide - C-terminal region

Fabp5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Klbp, mal1

UniProt

Q05816

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fabp5 Rabbit Polyclonal Antibody (orb584557) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034764

Preservative

Lyophilized powder

AA Sequence

RKTETVCTFQDGALVQHQQWDGKESTITRKLKDGKMIVECVMNNATCTRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adipose Triglyceride Lipase (PNPLA2) Goat Polyclonal Antibody
AP08794PU-N 50 µg

Adipose Triglyceride Lipase (PNPLA2) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Polr1a activation kit by CRISPRa
GA203701 1 Kit

Mouse Polr1a activation kit by CRISPRa

Sign In for Pricing
View Details
Snx20 Mouse Gene Knockout Kit (CRISPR)
KN516433 1 Kit

Snx20 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ethanesulfonic Acid
TRC-E937880-500MG 500 mg

Ethanesulfonic Acid

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS622626 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Ammonium-15N Bromide
TRC-A633847-10MG 10 mg

Ammonium-15N Bromide

Sign In for Pricing
View Details